- CLC Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89926
- Rabbit
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- BSF-3, BSF3, CISS2, CLC, NNT-1, NNT1, NR6
- Human
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- CLC
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: KTYDLTRYLE HQLRSLAGTY LNYLGPPFNE PDFNPPRLGA ETLPRATVDL EVWRSLNDKL RLTQNYE
- cardiotrophin like cytokine factor 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Apoptosis
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYE
Specifications/Features
Available conjugates: Unconjugated